TTC5 Rabbit Polyclonal Antibody

CAT#: TA329576

Rabbit polyclonal anti-TTC5 antibody

Product Images

WB Suggested Anti-TTC5 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TTC5 antibody: synthetic peptide directed towards the C terminal of human TTC5. Synthetic peptide located within the following region: GDSVAIPEPNLRLHRIQHKGKDYSFSSVRVETPLLLVVNGKPQGSSSQAV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: tetratricopeptide repeat domain 5
• Database Link:
  NP_612385
  Entrez Gene 91875 Human
  UniProt ID Q8N0Z6
• Background: TTC5 is an adapter protein involved in p53/TP53 response that acts by regulating and mediating the assembly of multi-protein complexes. It is required to facilitate the interaction between JMY and p300/EP300 and increase p53/TP53-dependent transcription and apoptosis. It prevents p53/TP53 degradation by MDM2.
• Synonyms: Strap
• Note: Immunogen sequence homology: Pig: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Horse: 93%; Guinea pig: 93%; Dog: 86%; Mouse: 86%; Rabbit: 86%