Atat1 Rabbit Polyclonal Antibody
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "Atat1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Rat |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Atat1 antibody is: synthetic peptide directed towards the middle region of Rat Atat1. Synthetic peptide located within the following region: WPLNRAPRRATPPAHPPPRSSSLGNSPDRGPLRPFVPEQELLRSLRLCPP |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 46 kDa |
Gene Name | alpha tubulin acetyltransferase 1 |
Database Link | |
Background | Atat1 specifically acetylates 'Lys-40' in alpha-tubulin on the lumenal side of microtubules. Atat1 may affect microtubule stability and regulate microtubule dynamics and may be involved in neuron development. |
Synonyms | 0610011P08Rik; 2610008K08Rik; 2610110G12Rik; 3110080J08Rik; Mec17; RGD1303066; RP24-180B11.6; TAT |
Note | Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%; Rabbit: 93% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.