Atat1 Rabbit Polyclonal Antibody

CAT#: TA329481

Rabbit Polyclonal anti-Atat1 Antibody

Product Images

WB Suggested Anti-Atat1 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Atat1 antibody is: synthetic peptide directed towards the middle region of Rat Atat1. Synthetic peptide located within the following region: WPLNRAPRRATPPAHPPPRSSSLGNSPDRGPLRPFVPEQELLRSLRLCPP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: alpha tubulin acetyltransferase 1
• Database Link:
  NP_997663
  Entrez Gene 361789 Rat
  UniProt ID Q6MG11
• Background: Atat1 specifically acetylates 'Lys-40' in alpha-tubulin on the lumenal side of microtubules. Atat1 may affect microtubule stability and regulate microtubule dynamics and may be involved in neuron development.
• Synonyms: 0610011P08Rik; 2610008K08Rik; 2610110G12Rik; 3110080J08Rik; Mec17; RGD1303066; RP24-180B11.6; TAT
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%; Rabbit: 93%