Taf12 Rabbit Polyclonal Antibody

CAT#: TA329242

Rabbit Polyclonal anti-Taf12 antibody

Product Images

WB Suggested Anti-Taf12 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:7812500; Positive Control: Mouse Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Taf12 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 18 kDa
• Gene Name: TATA-box binding protein associated factor 12
• Database Link:
  NP_079855
  Entrez Gene 66464 Mouse
  UniProt ID Q8VE65
• Background: TAFs are components of the transcription factor IID (TFIID) complex, PCAF histone acetylase complex and TBP-free TAFII complex (TFTC). TAFs components-TIIFD are essential for mediating regulation of RNA polymerase transcription.
• Synonyms: TAF2J; TAF15; TAFII-20/TAFII-15; TAFII20; TAFII20/TAFII15
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%