OriGene Logo
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Antibody All anti-LEP antibodies

Anti-LEP POLYCLONAL Antibody

div

Specifications Citations Customer Reviews Product Documents
SKU Description Amount Price Availability*  
TA346171 Rabbit Polyclonal Anti-LEP Antibody 50ug $325 3-7 Days
Add to Shopping Cart
spacer
WB(1)

OriGene Data

ImmunogenThe immunogen for anti-LEP antibody: synthetic peptide directed towards the middle region of human LEP. Synthetic peptide located within the following region: LHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDM
Clone Name IsotypeIgG
Species ReactivityHuman, Sheep, Goat, Horse, Rat, Bovine, Mouse, Rabbit, Pig, Dog ConcentrationLot dependent; please refer to CoA along with shipment
Guaranteed Application *WB Suggested DilutionsWB
Predicted MW Explanation 16kDa
BufferShipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Note Immunogen Sequence Homology: Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Pig: 93%; Rabbit: 93%; Dog: 86%

Reference Data

Target Nameleptin
Alternative NameLEPD|OB|OBS
Database LinkNP_000221
Entrez Gene 3952 Human
Entrez Gene 16846 Mouse
Entrez Gene 25608 Rat
Entrez Gene 0 Monkey
Entrez Gene 403616 Dog
FunctionLEP is a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing. Mutations in this gene and/or its regulatory regions cause severe obesity, and morbid obesity with hypogonadism. This gene has also been linked to type 2 diabetes mellitus development.This gene encodes a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing. Mutations in this gene and/or its regulatory regions cause severe obesity, and morbid obesity with hypogonadism. This gene has also been linked to type 2 diabetes mellitus development. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Related PathwaySecreted ProteinDruggable Genome Cytokine-cytokine receptor interactionNeuroactive ligand-receptor interactionJak-STAT signaling pathwayAdipocytokine signaling pathway

* Availability is in business days
* OriGene provides validated application data and protocol, with money back guarantee.


WB Image
WB Suggested Anti-LEP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HepG2 cell lysateLEP is supported by BioGPS gene expression data to be expressed in HepG2
grey_line

 

spacer
Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.

Acknowledge