OriGene Logo
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Antibody All anti-NIF3L1 antibodies

Anti-NIF3L1 Antibody Polyclonal

div

Specifications Citations Customer Reviews Product Documents
SKU Description Amount Price Availability*  
TA343236 Rabbit Polyclonal Anti-NIF3L1 Antibody 50ug $325 3-7 Days
LC427786 NIF3L1 HEK293T cell transient overexpression lysate (as WB positive control) 20ug $50 In Stock
Add to Shopping Cart
spacer
WB(1)
spacer
Also for NIF3L1 (NM_001136039)
cDNA Clone shRNA/siRNA CRISPR KO Kit Protein Antibody

OriGene Data

ImmunogenThe immunogen for anti-NIF3L1 antibody is: synthetic peptide directed towards the C-terminal region of Human NIF3L1. Synthetic peptide located within the following region: LDKVMSAVKGIDGVSVTSFSARTGNEEQTRINLNCTQKALMQVVDFLSRN
Clone NamePolyclonal IsotypeIgG
Species ReactivityHuman, Dog, Rabbit, Bovine, Goat ConcentrationLot dependent; please refer to CoA along with shipment
Guaranteed Application *WB Suggested DilutionsWB
Predicted MW Explanation 27kDa
BufferShipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Note Immunogen Sequence Homology: Human: 100%; Dog: 86%; Bovine: 86%; Rabbit: 86%; Goat: 79%

Reference Data

Target NameHomo sapiens NGG1 interacting factor 3 like 1 (NIF3L1), transcript variant 1
Alternative NameALS2CR1; CALS-7; MDS015
Database LinkNP_001129511
Entrez Gene 60491 Human
Entrez Gene 0 Mouse
Entrez Gene 0 Rat
Entrez Gene 0 Monkey
Entrez Gene 607446 Dog
FunctionThe function of this protein remains unknown.
Related Pathway

* Availability is in business days
* OriGene provides validated application data and protocol, with money back guarantee.


WB Image
Host: Rabbit; Target Name: NIF3L1; Sample Tissue: U937 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml
spacer

 

spacer
Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.

Acknowledge