OriGene Logo
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
Home Antibody All anti-ABAT antibodies

Anti-ABAT Antibody


Specifications Citations Customer Reviews Product Documents
SKU Description Amount Price Availability*  
TA339937 Rabbit Polyclonal Anti-ABAT Antibody 50ug $325 3-7 days
Add to Shopping Cart

OriGene Data

ImmunogenThe immunogen for anti-ABAT antibody: synthetic peptide directed towards the middle region of human ABAT. Synthetic peptide located within the following region: IIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFW
Clone Name IsotypeIgG
Species ReactivityBovine, Yeast, Human, Dog, Goat, Rabbit, Rat, Guinea pig, Mouse, Horse, Zebrafish Concentration1mg/mL
Guaranteed Application *WB Suggested DilutionsWB
Predicted MW Explanation 55kDa
BufferShipped as lyophilized powder. 1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Zebrafish: 86%

Reference Data

Target Name4-aminobutyrate aminotransferase
Alternative NameGABA-AT|GABAT|NPD009
Database LinkNP_065737
Entrez Gene 18 Human
Entrez Gene 268860 Mouse
Entrez Gene 81632 Rat
Entrez Gene 0 Monkey
Entrez Gene 479856 Dog
Function4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde. The active enzyme is a homodimer of 50-kD subunits complexed to pyridoxal-5-phosphate. ABAT in liver and brain is controlled by 2 codominant alleles with a frequency in a Caucasian population of 0.56 and 0.44. The ABAT deficiency phenotype includes psychomotor retardation, hypotonia, hyperreflexia, lethargy, refractory seizures, and EEG abnormalities.4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde. The active enzyme is a homodimer of 50-kD subunits complexed to pyridoxal-5-phosphate. The protein sequence is over 95% similar to the pig protein. GABA is estimated to be present in nearly one-third of human synapses. ABAT in liver and brain is controlled by 2 codominant alleles with a frequency in a Caucasian population of 0.56 and 0.44. The ABAT deficiency phenotype includes psychomotor retardation, hypotonia, hyperreflexia, lethargy, refractory seizures, and EEG abnormalities. Multiple alternatively spliced transcript variants encoding the same protein isoform have been found for this gene.
Related PathwayDruggable Genome Alanine, aspartate and glutamate metabolismValine, leucine and isoleucine degradationbeta-Alanine metabolismPropanoate metabolismButanoate metabolismMetabolic pathwaysMore Pathways >>

* Availability is in business days
* OriGene provides validated application data and protocol, with money back guarantee.

WB Image
WB Suggested Anti-ABAT Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Human Placenta

WB Image
Host: Rabbit; Target Name: ABAT; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0 ug/ml


Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.
