OriGene Logo
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Antibody All anti-MLEC antibodies

Anti-MLEC Antibody

div

Specifications Citations Customer Reviews Product Documents
SKU Description Amount Price Availability*  
TA339315 Rabbit Polyclonal Anti-KIAA0152 Antibody 50ug $325 3-7 days
LC415102 MLEC HEK293T cell transient overexpression lysate (as WB positive control) 20ug $50 In Stock
Add to Shopping Cart
spacer
WB(1)

OriGene Data

ImmunogenThe immunogen for anti-KIAA0152 antibody: synthetic peptide directed towards the C terminal of human KIAA0152. Synthetic peptide located within the following region: TVDDVPKLQPHPGLEKKEEEEEEEEYDEGSNLKKQTNKNRVQSGPRTPNP
Clone Name IsotypeIgG
Species ReactivityBovine, Mouse, Dog, Pig, Human, Horse, Rabbit, Rat, Zebrafish Concentration1mg/mL
Guaranteed Application *WB Suggested DilutionsWB
Predicted MW Explanation 32kDa
BufferShipped as lyophilized powder. 1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Protein A purified
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 93%

Reference Data

Target Namemalectin
Alternative NameKIAA0152
Database LinkNP_055545
Entrez Gene 9761 Human
Entrez Gene 109154 Mouse
Entrez Gene 304543 Rat
Entrez Gene 0 Monkey
Entrez Gene 609274 Dog
FunctionCarbohydrate-binding protein with a strong ligand preference for Glc2-N-glycan. May play a role in the early steps of protein N-glycosylation.
Related PathwayTransmembrane

* Availability is in business days
* OriGene provides validated application data and protocol, with money back guarantee.


WB Image
WB Suggested Anti-KIAA0152 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 721_B cell lysate.MLEC is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells
grey_line

 

spacer
Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.

Acknowledge