OriGene Logo
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Antibody All anti-GABRA3 antibodies

Anti-GABRA3 Antibody

div

Specifications Citations Customer Reviews Product Documents
SKU Description Amount Price Availability*  
TA338502 Rabbit Polyclonal Anti-GABRA3 Antibody 100ug $325 3-7 days
LC424511 GABRA3 HEK293T cell transient overexpression lysate (as WB positive control) 20ug $50 In Stock
Add to Shopping Cart
spacer
WB(1)
IHC(1)

OriGene Data

ImmunogenThe immunogen for anti-GABRA3 antibody: synthetic peptide directed towards the middle region of human GABRA3. Synthetic peptide located within the following region: AEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMT
Clone Name IsotypeIgG
Species ReactivityMouse, Human, Dog, Rat, Bovine, Horse, Rabbit, Guinea pig Concentration1mg/mL
Guaranteed Application *WB, IHC Suggested DilutionsWB, IHC
Predicted MW Explanation 55kDa
BufferShipped as lyophilized powder. 1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Protein A purified
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

Target NameHomo sapiens gamma-aminobutyric acid type A receptor alpha3 subunit (GABRA3)
Alternative NameMGC33793
Database LinkNP_000799
Entrez Gene 2556 Human
Entrez Gene 14396 Mouse
Entrez Gene 24947 Rat
Entrez Gene 0 Monkey
Entrez Gene 492223 Dog
FunctionGABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified. [provided by RefSeq, Jul 2008].
Related PathwayIon Channels: Cys-loop ReceptorsTransmembraneDruggable Genome Neuroactive ligand-receptor interaction

* Availability is in business days
* OriGene provides validated application data and protocol, with money back guarantee.


WB Image
WB Suggested Anti-GABRA3 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate
grey_line

IHC Image
mouse bulbus
grey_line

 

spacer
Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.

Acknowledge