OriGene Logo
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Antibody All anti-Gabra3 antibodies

Anti-Gabra3 Antibody

div

Specifications Citations Customer Reviews Product Documents
SKU Description Amount Price Availability*  
TA338501 Rabbit Polyclonal Anti-Gabra3 Antibody 50ug $325 3-7 days
Add to Shopping Cart
spacer
WB(1)

OriGene Data

ImmunogenThe immunogen for Anti-Gabra3 antibody is: synthetic peptide directed towards the N-terminal region of Rat Gabra3. Synthetic peptide located within the following region: LLISILPGTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIF
Clone Name IsotypeIgG
Species ReactivityMouse, Human, Dog, Rat, Bovine, Horse, Rabbit, Pig, Guinea pig Concentration1mg/mL
Guaranteed Application *WB Suggested DilutionsWB
Predicted MW Explanation 54kDa
BufferShipped as lyophilized powder. 1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 79%

Reference Data

Target NameHomo sapiens gamma-aminobutyric acid type A receptor alpha3 subunit (GABRA3)
Alternative NameMGC33793
Database LinkNP_000799
Entrez Gene 2556 Human
Entrez Gene 14396 Mouse
Entrez Gene 24947 Rat
Entrez Gene 0 Monkey
Entrez Gene 492223 Dog
Functionmay mediate inhibitory GABA responses; may play a role in synaptic transmission in the visual cortex [RGD, Feb 2006]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: X51991.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS160565, ERS240718 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## CDS uses downstream in-frame AUG :: downstream AUG is associated with N-terminal localization signal ##RefSeq-Attributes-END##
Related PathwayIon Channels: Cys-loop ReceptorsTransmembraneDruggable Genome Neuroactive ligand-receptor interaction

* Availability is in business days
* OriGene provides validated application data and protocol, with money back guarantee.


WB Image
Host: Rabbit; Target Name: Gabra3; Sample Tissue: Rat Kidney lysates; Antibody Dilution: 1.0 ug/ml
grey_line

 

spacer
Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.

Acknowledge