OriGene Logo
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Antibody All anti-N4BP2L1 antibodies

Anti-N4BP2L1 Antibody

div

Specifications Citations Customer Reviews Product Documents
SKU Description Amount Price Availability*  
TA337454 Rabbit Polyclonal Anti-N4BP2L1 Antibody 50ug $325 3-7 days
Add to Shopping Cart
spacer
WB(1)
spacer
Also for N4BP2L1 (NM_052818)
cDNA Clone shRNA/siRNA CRISPR KO Kit Protein Antibody

OriGene Data

ImmunogenThe immunogen for Anti-N4BP2L1 antibody is: synthetic peptide directed towards the C-terminal region of Human N4BP2L1. Synthetic peptide located within the following region: GVSREKIHRMKERYEHDVTFHSVLHAEKPSRMNRNQDRNNALPSNNARYW
Clone Name IsotypeIgG
Species ReactivityDog, Horse, Human, Rabbit, Yeast, Rat, Guinea pig, Mouse, Zebrafish ConcentrationLot dependent; please refer to CoA along with shipment
Guaranteed Application *WB Suggested DilutionsWB
Predicted MW Explanation 28kDa
BufferShipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Note Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Rabbit: 93%; Yeast: 89%; Pig: 85%; Rat: 85%; Mouse: 85%; Guinea pig: 85%; Zebrafish: 82%

Reference Data

Target NameNEDD4 binding protein 2-like 1
Alternative NameCG018
Database LinkNP_438169
Entrez Gene 90634 Human
Entrez Gene 100637 Mouse
Entrez Gene 498131 Rat
Entrez Gene 0 Monkey
Entrez Gene 607846 Dog
FunctionThe function of this protein remains unknown.
Related Pathway

* Availability is in business days
* OriGene provides validated application data and protocol, with money back guarantee.


WB Image
Host: Rabbit; Target Name: N4BP2L1; Sample Tissue: RPMI-8226 Whole Cell lysates; Antibody Dilution: 1.0 ug/mlN4BP2L1 is strongly supported by BioGPS gene expression data to be expressed in RPMI-8226
grey_line

 

spacer
Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.

Acknowledge