OriGene Logo
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Antibody All anti-GAB4 antibodies

Anti-GAB4 Antibody

div

Specifications Citations Customer Reviews Product Documents
SKU Description Amount Price Availability*  
TA337316 Rabbit Polyclonal Anti-GAB4 Antibody 50ug $325 3-7 days
LC421992 GAB4 HEK293T cell transient overexpression lysate (as WB positive control) 20ug $50 In Stock
Add to Shopping Cart
spacer
WB(1)
spacer
Also for GAB4 (NM_001037814)
cDNA Clone shRNA/siRNA CRISPR KO Kit Protein Antibody

OriGene Data

ImmunogenThe immunogen for Anti-GAB4 antibody is: synthetic peptide directed towards the C-terminal region of Human GAB4. Synthetic peptide located within the following region: GTSSSAPPRSTGNIHYAALDFQPSKPSIGSVTSGKKVDYVQVDLEKTQAL
Clone Name IsotypeIgG
Species ReactivityHuman ConcentrationLot dependent; please refer to CoA along with shipment
Guaranteed Application *WB Suggested DilutionsWB
Predicted MW Explanation 62kDa
BufferShipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Note Immunogen Sequence Homology: Human: 100%

Reference Data

Target NameGRB2 associated binding protein family member 4
Alternative Name-
Database LinkNP_001032903
Entrez Gene 128954 Human
Entrez Gene 0 Mouse
Entrez Gene 0 Rat
Entrez Gene 0 Monkey
Entrez Gene 0 Dog
FunctionThe function of this protein remains unknown.
Related Pathway

* Availability is in business days
* OriGene provides validated application data and protocol, with money back guarantee.


WB Image
Host: Rabbit; Target Name: GAB4; Sample Tissue: 293T Whole Cell lysates; Antibody Dilution: 1.0 ug/ml
grey_line

 

spacer
Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.

Acknowledge