OriGene Logo
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
Home Antibody All anti-FOLH1 antibodies

Anti-FOLH1 Antibody


Specifications Citations Customer Reviews Product Documents
SKU Description Amount Price Availability*  
TA336088 Rabbit Polyclonal Anti-FOLH1 Antibody 50ug $325 3-7 days
LC423102 FOLH1 HEK293T cell transient overexpression lysate (as WB positive control) 20ug $50 In Stock
Add to Shopping Cart

OriGene Data

ImmunogenThe immunogen for Anti-FOLH1 Antibody is: synthetic peptide directed towards the middle region of Human FOLH1. Synthetic peptide located within the following region: FSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSV
Clone Name IsotypeIgG
Species ReactivityHuman, Bovine, Dog, Horse, Rat, Guinea pig, Mouse, ConcentrationLot dependent; please refer to CoA along with shipment
Guaranteed Application *WB Suggested DilutionsWB
Predicted MW Explanation 48kDa
BufferShipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 85%

Reference Data

Target NameHomo sapiens folate hydrolase 1 (FOLH1), transcript variant 2
Database LinkNP_001014986
Entrez Gene 2346 Human
Entrez Gene 53320 Mouse
Entrez Gene 85309 Rat
Entrez Gene 0 Monkey
Entrez Gene 476775 Dog
FunctionThis gene encodes a type II transmembrane glycoprotein belonging to the M28 peptidase family. The protein acts as a glutamate carboxypeptidase on different alternative substrates, including the nutrient folate and the neuropeptide N-acetyl-l-aspartyl-l-glutamate and is expressed in a number of tissues such as prostate, central and peripheral nervous system and kidney. A mutation in this gene may be associated with impaired intestinal absorption of dietary folates, resulting in low blood folate levels and consequent hyperhomocysteinemia. Expression of this protein in the brain may be involved in a number of pathological conditions associated with glutamate excitotoxicity. In the prostate the protein is up-regulated in cancerous cells and is used as an effective diagnostic and prognostic indicator of prostate cancer. This gene likely arose from a duplication event of a nearby chromosomal region.
Related PathwayTransmembraneProteaseDruggable Genome

* Availability is in business days
* OriGene provides validated application data and protocol, with money back guarantee.

WB Image
Host: Rabbit; Target Name: FOLH1; Sample Tissue: RPMI-8226 Whole cell lysates; Antibody Dilution: 1.0 ug/ml


Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.
