OriGene Logo
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
Home Antibody All anti-DAPP1 antibodies

Anti-DAPP1 Antibody


Specifications Citations Customer Reviews Product Documents
SKU Description Amount Price Availability*  
TA334528 Rabbit Polyclonal Anti-DAPP1 Antibody 50ug $325 3-7 days
LC402326 DAPP1 HEK293T cell transient overexpression lysate (as WB positive control) 20ug $50 In Stock
Add to Shopping Cart
Also for DAPP1 (NM_014395)
cDNA Clone shRNA/siRNA CRISPR KO Kit Protein Antibody

OriGene Data

ImmunogenThe immunogen for anti-DAPP1 antibody: synthetic peptide directed towards the middle region of human DAPP1. Synthetic peptide located within the following region: SLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETG
Clone Name IsotypeIgG
Species ReactivityHuman, Rat, Dog, Horse, Rabbit, Guinea pig, Bovine ConcentrationLot dependent; please refer to CoA along with shipment
Guaranteed Application *WB Suggested DilutionsWB
Predicted MW Explanation 32 kDa
BufferShipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

Target Namedual adaptor of phosphotyrosine and 3-phosphoinositides 1
Alternative NameBAM32
Database LinkNP_055210
Entrez Gene 27071 Human
Entrez Gene 0 Mouse
Entrez Gene 362046 Rat
Entrez Gene 0 Monkey
Entrez Gene 478491 Dog
FunctionDAPP1 may act as a B-cell-associated adapter that regulates B-cell antigen receptor (BCR)-signaling downstream of PI3K.
Related PathwayPhosphataseDruggable Genome B cell receptor signaling pathway

* Availability is in business days
* OriGene provides validated application data and protocol, with money back guarantee.

WB Image
WB Suggested Anti-DAPP1 Antibody Titration: 0.2-1 ug/ml; Positive Control: OVCAR-3 cell lysateDAPP1 is supported by BioGPS gene expression data to be expressed in OVCAR3


Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.
