OriGene Logo
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Antibody All anti-KAT2B antibodies

Anti-KAT2B Antibody

div

Specifications Citations Customer Reviews Product Documents
SKU Description Amount Price Availability*  
TA330554 Rabbit Polyclonal Anti-PCAF Antibody 100ug $325 3-7 Days
LC418373 KAT2B HEK293T cell transient overexpression lysate (as WB positive control) 20ug $50 In Stock
Add to Shopping Cart
spacer
WB(1)
spacer
Also for KAT2B (NM_003884)
cDNA Clone shRNA/siRNA CRISPR KO Kit Protein Antibody

OriGene Data

ImmunogenThe immunogen for anti-PCAF antibody: synthetic peptide directed towards the N terminal of human PCAF. Synthetic peptide located within the following region: LFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPAK
Clone Name IsotypeIgG
Species ReactivityMouse, Rat, Bovine, Dog, Horse, Rabbit, Guinea pig, Human, Zebrafish ConcentrationLot dependent; please refer to CoA along with shipment
Guaranteed Application *WB Suggested DilutionsWB
Predicted MW Explanation 93kDa
BufferShipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 90%

Reference Data

Target NameHomo sapiens K(lysine) acetyltransferase 2B (KAT2B)
Alternative NameCAF; P/CAF; PCAF
Database LinkNP_003875
Entrez Gene 8850 Human
Entrez Gene 18519 Mouse
Entrez Gene 301164 Rat
Entrez Gene 477052 Dog
FunctionCBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. PCAF associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation.CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation.
Related PathwayTranscription FactorsDruggable Genome Notch signaling pathway

* Availability is in business days
* OriGene provides validated application data and protocol, with money back guarantee.


WB Image
WB Suggested Anti-PCAF Antibody Titration: 2.5ug/ml; Positive Control: HepG2 cell lysate
spacer

 

spacer
Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.

Acknowledge