OriGene Logo
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Antibody All anti-GABRA3 antibodies

Anti-GABRA3 Antibody

div

Specifications Citations Customer Reviews Product Documents
SKU Description Amount Price Availability*  
TA330435 Rabbit Polyclonal Anti-GABRA3 Antibody 100ug $325 3-7 Days
Add to Shopping Cart
spacer
IHC(1)

OriGene Data

ImmunogenThe immunogen for anti-GABRA3 antibody: synthetic peptide directed towards the N terminal of human GABRA3. Synthetic peptide located within the following region: GTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRILDRL
Clone Name IsotypeIgG
Species ReactivityMouse ConcentrationLot dependent; please refer to CoA along with shipment
Guaranteed Application *IHC Suggested DilutionsIHC
Predicted MW Explanation 55kDa
BufferShipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note Immunogen sequence homology: Bovine: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

Reference Data

Target NameHomo sapiens gamma-aminobutyric acid type A receptor alpha3 subunit (GABRA3)
Alternative NameMGC33793
Database LinkNP_000799
Entrez Gene 14396 Mouse
FunctionGABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the gaba/benzodiazepine receptor and opening an integral chloride channel.
Related PathwayIon Channels: Cys-loop ReceptorsTransmembraneDruggable Genome Neuroactive ligand-receptor interaction

* Availability is in business days
* OriGene provides validated application data and protocol, with money back guarantee.


IHC Image
mouse bulbus
grey_line

 

spacer
Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.

Acknowledge