OriGene Logo
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Antibody All anti-DYRK3 antibodies

Anti-DYRK3 POLYCLONAL Antibody

div

Specifications Citations Customer Reviews Product Documents
SKU Description Amount Price Availability*  
TA329166 Rabbit Polyclonal anti-DYRK3 antibody 50ug $325 3-7 Days
Add to Shopping Cart
spacer
WB(1)
IF(1)

OriGene Data

ImmunogenThe immunogen for anti-DYRK3 antibody: synthetic peptide directed towards the N terminal of human DYRK3. Synthetic peptide located within the following region: GDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKS
Clone Name IsotypeIgG
Species ReactivityHuman ConcentrationLot dependent; please refer to CoA along with shipment
Guaranteed Application *WB, IF Suggested DilutionsIF, WB
Predicted MW Explanation 66kDa
BufferShipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note Immunogen sequence homology: Human: 100%; Mouse: 86%

Reference Data

Target Namedual specificity tyrosine phosphorylation regulated kinase 3
Alternative NameDYRK5|RED|REDK|hYAK3-2
Database LinkNP_001004023
Entrez Gene 8444 Human
FunctionThis gene product belongs to the DYRK family of dual-specificity protein kinases that catalyze autophosphorylation on serine/threonine and tyrosine residues. The members of this family share structural similarity, however, differ in their substrate specificity, suggesting their involvement in different cellular functions. The encoded protein has been shown to autophosphorylate on tyrosine residue and catalyze phosphorylation of histones H3 and H2B in vitro. Alternatively spliced transcript variants encoding different isoforms have been identified.
Related PathwayProtein KinaseDruggable Genome

* Availability is in business days
* OriGene provides validated application data and protocol, with money back guarantee.


WB Image
WB Suggested Anti-DYRK3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: THP-1 cell lysate
grey_line

IF Image
Sample Type : HeLa cells Primary Antibody Dilution : 1:50 Secondary Antibody : Gaot anti-rabbit-Alexa Fluor Secondary Antibody Dilution : 1:250 Color/Signal Descriptions : Green: DYRK3 Red: PABP1 Blue: DAPIGene Name : DYRK3Submitted by : Frank Wippich, Institute of Molecular Life Sciences, University of Zurich
grey_line

 

spacer
Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.

Acknowledge