OriGene Technologies, Inc.
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Antibody All anti-PTGER4 antibodies

Anti-PTGER4 Antibody

div

Specifications Citations Related Products Product Documents
SKU Description Amount Price Availability*  
TA318689
  • PTGER4 / EP4 Rabbit Polyclonal Antibody
250ul 345 3-7 Days
Add to Shopping Cart
IHC(1)
spacer
Also for PTGER4 (NM_000958)
cDNA Clone shRNA/siRNA Lysate Protein Antibody

OriGene Data

ImmunogenHuman EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey (100%); Gibbon, Bovine (97%); Rabbit (93%); Marmoset (90%); Bat, Hamster, Elephant, Panda (87%) ...
Clone Name IsotypeIgG
Species ReactivityHuman, Mouse, Rat, Sheep Concentration0.2 mg/ml
Guaranteed Application *IHC Suggested DilutionsICC, IHC-P (5 µg/ml), WB (1:200)
BufferTBS, pH 7.4, 0.02% sodium azide, 0.5 mg/ml BSA, 50% glycerol.
Purification Affinity Purified
Note Does not cross-react with EP1, EP3, or EP4 receptors. The EP2 receptor appears to be expressed at low levels in many tissues and cell types, potentially making detection by immunochemical techniques difficult.

Reference Data

Target NameHomo sapiens prostaglandin E receptor 4 (subtype EP4) (PTGER4)
Alternative NameEP4; EP4R
Database LinkNP_000949
Entrez Gene 5734 Human
Entrez Gene 19219 Mouse
Entrez Gene 84023 Rat
Function
Related PathwayGPCRTransmembraneDruggable Genome Neuroactive ligand-receptor interaction

* Availability is in business days
* OriGene provides validated application data and protocol, with money back guarantee.

IHC Image
Anti-PTGER4 / EP4 antibody IHC staining of human prostate. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

 

spacer
Inc 5000 Healthcare Company Copyright © 2014 OriGene Technologies, Inc. All Rights Reserved. Legal Notices.
9620 Medical Center Dr., Suite 200, Rockville, MD 20850 • 1.888.267.4436

Reproduction of any materials from this website is strictly forbidden without permission.

All Products by: Title | Price | Category | Popularity | Best Sellers Topselling Products by: Title | Price | Category | Popularity | Favorites
Popular Categories: Popularity | Our Choices | All-Round Favorites | Title Topselling Categories: Popularity | Our Choices | All-Round Favorites | Title