GFRAL Rabbit Polyclonal Antibody

CAT#: TA331490

Rabbit Polyclonal Anti-GFRAL Antibody

Product Images

Host: Rabbit; Target Name: GFRAL; Sample Tissue: Hela Whole cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GFRAL Antibody is: synthetic peptide directed towards the N-terminal region of Human GFRAL. Synthetic peptide located within the following region: TDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: GDNF family receptor alpha like
• Database Link:
  NP_997293
  Entrez Gene 389400 Human
  UniProt ID Q6UXV0
• Background: The function of this protein remains unknown.
• Synonyms: bA360D14.1; C6orf144; GRAL; UNQ9356
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 92%; Bovine: 85%; Pig: 77%

Reference Data

• Protein Families: Druggable Genome, Transmembrane