OriGene Technologies, Inc.
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
Home Antibody All anti-ABCC1 antibodies

Anti-ABCC1 Antibody IU5C1


Specifications Citations Related Products Product Documents
SKU Description Amount Price Availability*  
  • Mouse Monoclonal MRP1 Antibody (IU5C1)
  • FREE positive control: HEK293T cell transient overexpression lysate (LC417598) , 20ug
0.1ml $325 In Stock
Add to Shopping Cart

OriGene Data

ImmunogenA recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of the human protein. [Swiss-Prot# P33527]
Clone NameIU5C1 IsotypeIgG1
Species ReactivityHuman, Mouse Concentration0.5~1.0 mg/ml (Lot Dependent)
Guaranteed Application *WB, IF Suggested DilutionsWB, IF
Buffer0.1% Sodium Azide
Purification Ascites

Reference Data

Target NameHomo sapiens ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1)
Alternative NameABC29; ABCC; GS-X; MRP; MRP1
Database LinkNP_004987
Related Pathway

* Shipping is in business days
* OriGene provides validated application data and protocol, with money back guarantee.

WB Image
Western Blot: MRP1 Antibody (IU5C1) -Detection of MRP1 in 10 ug of 293 transfected (lane 2) and empty vector (lane 1) lysate.
IF Image
Immunofluorescence: MRP1 Antibody (IU5C1) - Immunofluorescent staining of MRP1 using anti-MRP1 in HEK293 cells with MRP1 expression.


Inc 5000 Healthcare Company Copyright © 2014 OriGene Technologies, Inc. All Rights Reserved. Legal Notices.
9620 Medical Center Dr., Suite 200, Rockville, MD 20850 • 1.888.267.4436

Reproduction of any materials from this website is strictly forbidden without permission.

All Products by: Title | Price | Category | Popularity | Best Sellers Topselling Products by: Title | Price | Category | Popularity | Favorites
Popular Categories: Popularity | Our Choices | All-Round Favorites | Title Topselling Categories: Popularity | Our Choices | All-Round Favorites | Title