OriGene Logo
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
Home Antibody All anti-ABCC1 antibodies

Anti-ABCC1 Antibody IU5C1

Specifications Citations Customer Reviews Product Documents
SKU Description Amount Price Availability*  
TA309560 Mouse Monoclonal MRP1 Antibody (IU5C1) 0.1ml $325 2 Weeks
LC417598 ABCC1 HEK293T cell transient overexpression lysate (as WB positive control) 20ug $50 In Stock
Add to Shopping Cart
Write Review & Get Rewarded

Write a review and get rewarded!

Review this antibody and earn an OriGene coupon or Amazon giftcard

Follow these easy steps to reward yourself:

  1. Sign in to your account, or register for a new account;
  2. Write a review;
  3. Receive a coupon or giftcard once your review is accepted.

Click the button to start writing a review

OriGene Data

ImmunogenA recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of the human protein. [Swiss-Prot# P33527]
Clone NameIU5C1 IsotypeIgG1
Species ReactivityHuman, Mouse ConcentrationLot dependent; please refer to CoA along with shipment
Guaranteed Application *WB, IF Suggested DilutionsWB, IF
Buffer0.1% Sodium Azide
Purification Ascites

Reference Data

Target NameHomo sapiens ATP binding cassette subfamily C member 1 (ABCC1)
Alternative NameABC29; ABCC; GS-X; MRP; MRP1
Database LinkNP_004987
Entrez Gene 4363 Human
Entrez Gene 17250 Mouse
Related PathwayTransmembraneDruggable Genome ABC transporters

* Availability is in business days
* OriGene provides validated application data and protocol, with money back guarantee.

WB Image
Western Blot: MRP1 Antibody (IU5C1) -Detection of MRP1 in 10 ug of 293 transfected (lane 2) and empty vector (lane 1) lysate.

IF Image
Immunofluorescence: MRP1 Antibody (IU5C1) - Immunofluorescent staining of MRP1 using anti-MRP1 in HEK293 cells with MRP1 expression.

Inc 5000 Healthcare Company
All Products by: Title | Price | Category | Popularity | Best Sellers Topselling Products by: Title | Price | Category | Popularity | Favorites
Popular Categories: Popularity | Our Choices | All-Round Favorites | Title Topselling Categories: Popularity | Our Choices | All-Round Favorites | Title

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.