OriGene Logo
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Recombinant Human Proteins All CCL13 Proteins

CCL13 (NM_005408) Purified Human Protein

Specifications Citations Customer Service Product Documents
Cat. No. Description Datasheet Price Availability*  
TP723286 Purified recombinant protein of Human chemokine (C-C motif) ligand 13 (CCL13)., 20 ug (Larger pack size?) 199
$139
5 Days
Add to Shopping Cart
spacer
Also for CCL13 (NM_005408)
cDNA Clone shRNA/siRNA CRISPR KO Kit Protein Antibody

OriGene Data
Species:Human Expression Host:E. coli
Expression cDNA Clone or AA Sequence
QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
Tag:Tag-free Predicted MW:8.6 kDa
Purity:>95% as determined by SDS-PAGE and Coomassie blue staining
Concentration:Resuspend the protein in the desired concentration in proper buffer
Buffer:Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
BioActivity: Determined by its ability to chemoattract human monocytes using a concentration of 10.0-100.0 ng/ml.
Protein Families: Secreted ProteinDruggable Genome
Protein Pathways: Cytokine-cytokine receptor interactionChemokine signaling pathwayNOD-like receptor signaling pathway
Protein Data
Protein Image
 

Reference Data
RefSeq: NP_005399 RefSeq Size: 861 RefSeq ORF: 294
LocusID: 6357 Cytogenetic: 17q12  
Synonyms : CKb10; MCP-4; NCC-1; NCC1; SCYA13; SCYL1
Summary: This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. This chemokine plays a role in accumulation of leukocytes during inflammation. It may also be involved in the recruitment of monocytes into the arterial wall during artherosclerosis. [provided by RefSeq, Sep 2014].
*: Inventory for certain proteins may be limited due to low expression level. Delivery time may vary from web posted schedule. Contact techsupport@origene.com for specific inventory information
**: DDK-tag is the same as FLAG tag. Flag® is a registered trademark of Sigma-Aldrich

 

bar
Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.

Acknowledge