OriGene Logo
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Recombinant Human Proteins All FGF18 Proteins

FGF18 (NM_003862) Purified Human Protein

Specifications Citations Customer Service Product Documents
Cat. No. Description Datasheet Price Availability*  
TP723093 Purified recombinant protein of Human fibroblast growth factor 18 (FGF18)., 25 µg (Larger pack size?) 199
$139
5 Days
Add to Shopping Cart
spacer
Also for FGF18 (NM_003862)
cDNA Clone shRNA/siRNA CRISPR KO Kit Protein Antibody

OriGene Data
Species:Human Expression Host:E. coli
Expression cDNA Clone or AA Sequence
AEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSR
Tag:Tag-free Predicted MW:20.1 kDa
Purity:>95% as determined by SDS-PAGE and Coomassie blue staining
Concentration:Resuspend the protein in the desired concentration in proper buffer
Buffer:Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
BioActivity: ED50 as determined by the dose-dependent stimulation of thymidine uptake by BaF3 cells expressing FGF-receptors is less than or equal to 0.5 ng/ml, corresponding to a specific activity of > 2 x 10^6 units/mg.
Protein Families: Secreted ProteinES Cell Differentiation/IPS
Protein Pathways: MAPK signaling pathwayRegulation of actin cytoskeletonPathways in cancerMelanoma
Protein Data
Protein Image
 

Reference Data
RefSeq: NP_003853 RefSeq Size: 1546 RefSeq ORF: 621
LocusID: 8817 Cytogenetic: 5q35.1  
Synonyms : FGF-18; ZFGF5
Summary: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. It has been shown in vitro that this protein is able to induce neurite outgrowth in PC12 cells. Studies of the similar proteins in mouse and chick suggested that this protein is a pleiotropic growth factor that stimulates proliferation in a number of tissues, most notably the liver and small intestine. Knockout studies of the similar gene in mice implied the role of this protein in regulating proliferation and differentiation of midline cerebellar structures. [provided by RefSeq, Jul 2008]
*: Inventory for certain proteins may be limited due to low expression level. Delivery time may vary from web posted schedule. Contact techsupport@origene.com for specific inventory information
**: DDK-tag is the same as FLAG tag. Flag® is a registered trademark of Sigma-Aldrich

 

bar
Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.

Acknowledge