OriGene Logo
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Recombinant Human Proteins All BTC Proteins

BTC (NM_001729) Purified Human Protein

Specifications Citations Customer Service Product Documents
Cat. No. Description Datasheet Price Availability*  
TP723036 Purified recombinant protein of Human betacellulin (BTC)., 20 ug (Larger pack size?) 199
$139
5 Days
Add to Shopping Cart
spacer
OriGene Data
Species:Human Expression Host:E. coli
Expression cDNA Clone or AA Sequence
DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY
Tag:Tag-free Predicted MW:9 kDa
Purity:>95% as determined by SDS-PAGE and Coomassie blue staining
Concentration:Resuspend the protein in the desired concentration in proper buffer
Buffer:Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
BioActivity: ED50 was determined by the dose-dependent stimulation of the proliferation of murine Balb/3T3 cells is less than or equal to 0.05 ng/ml, corresponding to a specific activity of > 2 x 10^7units/mg.
Protein Families: Secreted ProteinES Cell Differentiation/IPSTransmembraneDruggable Genome
Protein Pathways: ErbB signaling pathway
Protein Data
Protein Image
 

Reference Data
RefSeq: NP_001720 RefSeq Size: 1271 RefSeq ORF: 534
LocusID: 685 Cytogenetic: 4q13.3  
Synonyms : OTTHUMP00000160600; betacellulin
Summary: This gene encodes a member of the epidermal growth factor (EGF) family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the secreted growth factor. A secreted form and a membrane-anchored form of this protein bind to multiple different EGF receptors. This protein promotes pancreatic cell proliferation and insulin secretion, as well as retinal vascular permeability. Mutations in this gene may be associated with type 2 diabetes in human patients. [provided by RefSeq, Nov 2015].
*: Inventory for certain proteins may be limited due to low expression level. Delivery time may vary from web posted schedule. Contact techsupport@origene.com for specific inventory information
**: DDK-tag is the same as FLAG tag. Flag® is a registered trademark of Sigma-Aldrich

 

bar
Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.

Acknowledge