OriGene Logo
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Recombinant Human Proteins All APOE Proteins

APOE (NM_000041) Purified Human Protein

Specifications Citations Customer Service Product Documents
Cat. No. Description Datasheet Price Availability*  
TP721217 Purified recombinant protein of Human apolipoprotein E (APOE), 50 ug (Larger pack size?) $139 5 days
Add to Shopping Cart
spacer
OriGene Data
Species:Human Expression Host:HEK293 cells
Expression cDNA Clone or AA Sequence
KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNHVDHHHHHH
Tag:C-terminal HIS Predicted MW:35.3kD
Purity:>95% as determined by SDS-PAGE and Coomassie blue staining
Concentration:Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Buffer:Lyophilized from a 0.2 µM filtered solution of 20mM PB,150mM NaCl,pH7.4
Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Protein Families: Secreted ProteinStem cell - PluripotencyAdult stem cellsDruggable Genome
Protein Pathways: Alzheimer's disease
 

Reference Data
RefSeq: NP_000032 RefSeq Size: 1223 RefSeq ORF: 951
LocusID: 348 Cytogenetic: 19q13.32  
Synonyms : AD2; APO-E; LDLCQ5; LPG
Summary: The protein encoded by this gene is a major apoprotein of the chylomicron. It binds to a specific liver and peripheral cell receptor, and is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. This gene maps to chromosome 19 in a cluster with the related apolipoprotein C1 and C2 genes. Mutations in this gene result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants. [provided by RefSeq, Jun 2016]
*: Inventory for certain proteins may be limited due to low expression level. Delivery time may vary from web posted schedule. Contact techsupport@origene.com for specific inventory information
**: DDK-tag is the same as FLAG tag. Flag® is a registered trademark of Sigma-Aldrich

 

bar
Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.

Acknowledge