OriGene Logo
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Recombinant Human Proteins All JAM2 Proteins

JAM2 (NM_021219) Purified Human Protein

Specifications Citations Customer Service Product Documents
Cat. No. Description Datasheet Price Availability*  
TP721088 Purified recombinant protein of Human junctional adhesion molecule 2 (JAM2), 10 ug (Larger pack size?) $139 5 days
Add to Shopping Cart
spacer
OriGene Data
Species:Human Expression Host:HEK293 cells
Expression cDNA Clone or AA Sequence
FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Tag:C-terminal Fc tag Predicted MW:50.3kD
Purity:>95% as determined by SDS-PAGE and Coomassie blue staining
Concentration:Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Buffer:Lyophilized from a 0.2 µM filtered solution of PBS,pH 7.4
Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Protein Families: TransmembraneDruggable Genome
Protein Pathways: Cell adhesion molecules (CAMs)Tight junctionLeukocyte transendothelial migrationEpithelial cell signaling in Helicobacter pylori infection
 

Reference Data
RefSeq: NP_067042 RefSeq Size: 1721 RefSeq ORF: 894
LocusID: 58494 Cytogenetic: 21q21.3  
Synonyms : C21orf43; CD322; JAM-B; JAMB; PRO245; VE-JAM; VEJAM
Summary: This gene belongs to the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. The protein encoded by this gene is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. It acts as an adhesive ligand for interacting with a variety of immune cell types, and may play a role in lymphocyte homing to secondary lymphoid organs. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2012].
*: Inventory for certain proteins may be limited due to low expression level. Delivery time may vary from web posted schedule. Contact techsupport@origene.com for specific inventory information
**: DDK-tag is the same as FLAG tag. Flag® is a registered trademark of Sigma-Aldrich

 

bar
Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.

Acknowledge