OriGene Logo
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Recombinant Human Proteins All FGF23 Proteins

FGF23 (NM_020638) Purified Human Protein

Specifications Citations Customer Service Product Documents
Cat. No. Description Datasheet Price Availability*  
TP720743 Purified recombinant protein of Human fibroblast growth factor 23 (FGF23), 10 ug (Larger pack size?) $139 5 days
Add to Shopping Cart
spacer
Also for FGF23 (NM_020638)
cDNA Clone shRNA/siRNA CRISPR KO Kit Protein Antibody

OriGene Data
Species:Human Expression Host:HEK293 cells
Expression cDNA Clone or AA Sequence
YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFIVDHHHHHH
Tag:C-terminal HIS Predicted MW:26.4kD
Purity:>95% as determined by SDS-PAGE and Coomassie blue staining
Concentration:Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Buffer:Lyophilized from a 0.2 µM filtered solution of 20mM PB,150mM NaCl,1mM EDTA,2mMDTT,pH7.4
Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Protein Families: Secreted ProteinDruggable Genome
Protein Pathways: MAPK signaling pathwayRegulation of actin cytoskeletonPathways in cancerMelanoma
 

Reference Data
RefSeq: NP_065689 RefSeq Size: 3018 RefSeq ORF: 753
LocusID: 8074 Cytogenetic: 12p13.32  
Synonyms : ADHR; FGFN; HPDR2; HYPF; PHPTC
Summary: This gene encodes a member of the fibroblast growth factor family of proteins, which possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. The product of this gene regulates phosphate homeostasis and transport in the kidney. The full-length, functional protein may be deactivated via cleavage into N-terminal and C-terminal chains. Mutation of this cleavage site causes autosomal dominant hypophosphatemic rickets (ADHR). Mutations in this gene are also associated with hyperphosphatemic familial tumoral calcinosis (HFTC). [provided by RefSeq, Feb 2013]
*: Inventory for certain proteins may be limited due to low expression level. Delivery time may vary from web posted schedule. Contact techsupport@origene.com for specific inventory information
**: DDK-tag is the same as FLAG tag. Flag® is a registered trademark of Sigma-Aldrich

 

bar
Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.

Acknowledge