OriGene Logo
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Recombinant Human Proteins All CCL28 Proteins

CCL28 (NM_148672) Purified Human Protein

Specifications Citations Customer Service Product Documents
Cat. No. Description Datasheet Price Availability*  
TP720605 Purified recombinant protein of Human chemokine (C-C motif) ligand 28 (CCL28), 10 ug (Larger pack size?) $119 5 days
Add to Shopping Cart
spacer
Also for CCL28 (NM_148672)
cDNA Clone shRNA/siRNA CRISPR KO Kit Protein Antibody

OriGene Data
Species:Human Expression Host:E. coli
Expression cDNA Clone or AA Sequence
MSEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY
Tag:Tag-free Predicted MW:12.49kD
Purity:>95% as determined by SDS-PAGE and Coomassie blue staining
Concentration:Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Buffer:Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Protein Families: Secreted ProteinDruggable Genome
Protein Pathways: Cytokine-cytokine receptor interactionChemokine signaling pathway
 

Reference Data
RefSeq: NP_683513 RefSeq Size: 816 RefSeq ORF: 381
LocusID: 56477 Cytogenetic: 5p12  
Synonyms : CCK1; MEC; SCYA28
Summary: This antimicrobial gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for resting CD4 or CD8 T cells and eosinophils. The product of this gene binds to chemokine receptors CCR3 and CCR10. This chemokine may play a role in the physiology of extracutaneous epithelial tissues, including diverse mucosal organs. Multiple transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Sep 2014].
*: Inventory for certain proteins may be limited due to low expression level. Delivery time may vary from web posted schedule. Contact techsupport@origene.com for specific inventory information
**: DDK-tag is the same as FLAG tag. Flag® is a registered trademark of Sigma-Aldrich

 

bar
Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.

Acknowledge