Cathepsin B (CTSB) (NM_147781) Human Recombinant Protein

CAT#: TP322764

Purified recombinant protein of Homo sapiens cathepsin B (CTSB), transcript variant 3, 20 µg

Product Images

Coomassie blue staining of purified CTSB protein (Cat# TP322764). The protein was produced from HEK293T cells transfected with CTSB cDNA clone (Cat# RC222764) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC222764 protein sequence
  Red=Cloning site Green=Tags(s)
  
  XCGSSGPPSAACWCWPMPGAGPLSIPCRMSWSTMSTNGIPRGRPGTTSTTWT*AT*RGYVVPSWVGPSHP
  RELCLPRT*SCLQASMHGNNGHSVPPSKRSETRAPVAPAGPSGLWKPSLTGSASTPMRTSAWRCRRRTCS
  HAVAACVGTAVMVAILLKLGTSGQEKAWFLVASMNPM*GADRTPSLPVSTTSTAPGPHARGREIPPSVAR
  SVSLATARPTNRTSTTDTIPTASPIARRTSWPRSTKTAPWRELSLCIRTSCSTSQECTNTSPER*WVAMP
  SASWAGEWRMAHPTGWLPTPGTLTGVTMASLKYSEDRITVESNQKWWLEFHAPISTGKR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 35.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_680091
• Locus ID: 1508
• UniProt ID: P07858, A0A024R374
• Cytogenetics: 8p23.1
• Refseq Size: 3902
• Refseq ORF: 1017
• Synonyms: APPS; CPSB; RECEUP
• Summary: This gene encodes a member of the C1 family of peptidases. Alternative splicing of this gene results in multiple transcript variants. At least one of these variants encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include the cathepsin B light and heavy chains, which can dimerize to form the double chain form of the enzyme. This enzyme is a lysosomal cysteine protease with both endopeptidase and exopeptidase activity that may play a role in protein turnover. It is also known as amyloid precursor protein secretase and is involved in the proteolytic processing of amyloid precursor protein (APP). Incomplete proteolytic processing of APP has been suggested to be a causative factor in Alzheimer's disease, the most common cause of dementia. Overexpression of the encoded protein has been associated with esophageal adenocarcinoma and other tumors. Both Cathepsin B and Cathepsin L are involved in the cleavage of the spike protein from the severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) upon its entry to the human host cell. Multiple pseudogenes of this gene have been identified. [provided by RefSeq, Sep 2020]
• Protein Families: Druggable Genome, Protease
• Protein Pathways: Antigen processing and presentation, Lysosome