Salivary alpha amylase (AMY1A) (NM_004038) Human Recombinant Protein
CAT#: TP317403
Recombinant protein of human amylase, alpha 1A (salivary) (AMY1A), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217403 representing NM_004038
Red=Cloning site Green=Tags(s) MKLFWLLFTIGFCWAQYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPF RPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRD FPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFR IDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTV IRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGF TRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQP FTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKA HFSISNSAEDPFIAIHAESKL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 55.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004029 |
Locus ID | 276 |
UniProt ID | P04745, Q6NSB3 |
Cytogenetics | 1p21.1 |
Refseq Size | 1862 |
Refseq ORF | 1533 |
Synonyms | AMY1 |
Summary | Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the salivary gland. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008] |
Protein Families | ES Cell Differentiation/IPS, Secreted Protein |
Protein Pathways | Metabolic pathways, Starch and sucrose metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418295 | AMY1A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC423398 | AMY1A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY418295 | Transient overexpression lysate of amylase, alpha 1A (salivary) (AMY1A), transcript variant 1 |
USD 436.00 |
|
LY423398 | Transient overexpression lysate of amylase, alpha 1A (salivary) (AMY1A), transcript variant 2 |
USD 436.00 |
|
PH317403 | AMY1A MS Standard C13 and N15-labeled recombinant protein (NP_004029) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review