Aspartate Aminotransferase (GOT1) (NM_002079) Human Recombinant Protein
CAT#: TP301757
Recombinant protein of human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201757 protein sequence
Red=Cloning site Green=Tags(s) MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWVLPVVKKVEQKIANDNSLNHE YLPILGLAEFRSCASRLALGDDSPALKEKRVGGVQSLGGTGALRIGADFLARWYNGTNNKNTPVYVSSPT WENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIA SVMKHRFLFPFFDSAYQGFASGNLERDAWAIRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPES ILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRARLEALKTPGT WNHITDQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKIQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002070 |
Locus ID | 2805 |
UniProt ID | P17174, A0A140VK69 |
Cytogenetics | 10q24.2 |
Refseq Size | 2140 |
Refseq ORF | 1239 |
Synonyms | AST1; ASTQTL1; cAspAT; cCAT; GIG18 |
Summary | Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. [provided by RefSeq, Jul 2008] |
Protein Pathways | Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, Cysteine and methionine metabolism, Metabolic pathways, Phenylalanine, tyrosine and tryptophan biosynthesis, Phenylalanine metabolism, Tyrosine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400762 | GOT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400762 | Transient overexpression lysate of glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1) |
USD 436.00 |
|
PH301757 | GOT1 MS Standard C13 and N15-labeled recombinant protein (NP_002070) |
USD 3,255.00 |
|
TP720124 | Recombinant protein of human glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review