GTL3 (CFAP20) (NM_013242) Human Recombinant Protein

CAT#: TP301017

Recombinant protein of human chromosome 16 open reading frame 80 (C16orf80), 20 µg

Product Images

Coomassie blue staining of purified CFAP20 protein (Cat# TP301017). The protein was produced from HEK293T cells transfected with CFAP20 cDNA clone (Cat# RC201017) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201017 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLG
  IKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFT
  RRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_037374
• Locus ID: 29105
• UniProt ID: Q9Y6A4
• Cytogenetics: 16q21
• Refseq Size: 1308
• Refseq ORF: 579
• Synonyms: BUG22; C16orf80; EVORF; fSAP23; GTL3
• Summary: Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. Involved in the regulation of the size and morphology of cilia (PubMed:24414207). Required for axonemal microtubules polyglutamylation (PubMed:24414207).[UniProtKB/Swiss-Prot Function]
• Protein Families: Transcription Factors