Mfsd7b (BC024751) Mouse Tagged ORF Clone

CAT#: MR201784

(Myc-DDK-tagged) - Mouse cDNA clone MGC:38916 IMAGE:5362476

Product Images

Circular map for MR201784

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Mfsd7b
• Synonyms: 9630055N22Rik; FLVCR; Flvcr1
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR201784 representing BC024751
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGACAAGACTGGTTTGTCTTTCTGAGGAGAGAGTGGTAGCTAGCTGCATTATTCTCTGCAGAGGGACCC
  ACTCACAGCTCTGTCTTTGTTTTAGGCAGACAACTCTGATAGTGTACGTTCTGTCTTTCATTGGAATGCT
  CATATTCACATTCACACTGAACCTCGGGTACATCATCGTGGTGTTTTTTACTGGTGGGATTCTTGGCTTC
  TTCATGACTGGTTACCTCCCGCTGGGCTTTGAGTTTGCTGTGGAGATCACCTACCCTGAGTCTGAGGGCA
  TGTCCTCAGGGCTCCTCAACACTGCTGCACAGATACTTGGAATTTTCTTCACATTGGCTCAAGGAAAGAT
  CACAACAGACTATAATAGTCCAGAGGCAGGAAACATTTTCCTTTGTGCCTGGATGTTTGTAGGCATAATT
  TTAACAGCGTTGATCAAGTCTGATCTGAGAAGGCACAATATAAACACCGGGCTTACAAACATTGACGTTA
  AAGCTGTACCAGTTGATAGTCGGGTAGATCCAAAACCCAAAGTGATGGTGTCTATACAGTCGGAATCTTC
  ACTC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR201784 representing BC024751
  Red=Cloning site Green=Tags(s)
  
  MTRLVCLSEERVVASCIILCRGTHSQLCLCFRQTTLIVYVLSFIGMLIFTFTLNLGYIIVVFFTGGILGF
  FMTGYLPLGFEFAVEITYPESEGMSSGLLNTAAQILGIFFTLAQGKITTDYNSPEAGNIFLCAWMFVGII
  LTALIKSDLRRHNINTGLTNIDVKAVPVDSRVDPKPKVMVSIQSESSL
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: BC024751
• ORF Size: 564 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: BC024751.1
• RefSeq Size: 3063 bp
• RefSeq ORF: 566 bp
• Locus ID: 226844
• Cytogenetics: 1 H6
• MW: 112.3 kDa
• Gene Summary: Isoform 1: Heme transporter that exports cytoplasmic heme. It can also export coproporphyrin and protoporphyrin IX, which are both intermediate products in the heme biosynthetic pathway. Does not export bilirubin. Heme export depends on the presence of HPX and is required to maintain intracellular free heme balance, protecting cells from heme toxicity. Heme export provides protection from heme or ferrous iron toxicities in liver, brain, sensory neurons and during erythtopoiesis, a process in which heme synthesis intensifies. Causes susceptibility to FeLV-C in vitro.[UniProtKB/Swiss-Prot Function]