FAM164B (ZC2HC1B) (NM_001013623) Human Mass Spec Standard

CAT#: PH325272

C6orf94 MS Standard C13 and N15-labeled recombinant protein (NP_001013645)

Product Images

Coomassie blue staining of purified ZC2HC1B protein (Cat# TP325272). The protein was produced from HEK293T cells transfected with ZC2HC1B cDNA clone (Cat# RC225272) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC225272
• Predicted MW: 24.5 kDa
• Protein Sequence:
  Sequence Link

  >RC225272 representing NM_001013623
  Red=Cloning site Green=Tags(s)
  
  MAGAEPFLADGNQELFPCEVCGRRFAADVLERHGPICKKLFNRKRKPFSSLKQRLQGTDIPTVKKTPQSK
  SPPVRKSNWRQQHEDFINAIRSAKQCMLAIKEGRPLPPPPPPSLNPDYIQRPYCMRRFNESAAERHTNFC
  KDQSSRRVFNPAQTAAKLASRAQGRAQMGPKKEPTVTSAVGALLQNRVLVATNEVPTKSGLAMDPASGAK
  LRQGFSKSSKKD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001013645
• RefSeq ORF: 666
• Synonyms: C6orf94; dJ468K18.5; FAM164B
• Locus ID: 153918
• UniProt ID: Q5TFG8
• Cytogenetics: 6q24.2