Histone H2A Bbd (H2AFB2) (NM_001017991) Human Mass Spec Standard
CAT#: PH323551
H2AFB2 MS Standard C13 and N15-labeled recombinant protein (NP_001017991)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223551 |
Predicted MW | 12.7 kDa |
Protein Sequence |
>RC223551 protein sequence
Red=Cloning site Green=Tags(s) MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLEL AGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001017991 |
RefSeq Size | 594 |
RefSeq ORF | 345 |
Synonyms | H2A.Bbd; H2AB3; H2AFB2 |
Locus ID | 474381 |
UniProt ID | P0C5Z0 |
Cytogenetics | Xq28 |
Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. This gene is part of a region that is repeated three times on chromosome X, once in intron 22 of the F8 gene and twice closer to the Xq telomere. This record represents the middle copy. [provided by RefSeq, Oct 2015] |
Protein Pathways | Systemic lupus erythematosus |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422230 | H2AFB2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY422230 | Transient overexpression lysate of H2A histone family, member B2 (H2AFB2) |
USD 436.00 |
|
TP323551 | Recombinant protein of human H2A histone family, member B2 (H2AFB2), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review