INDOL1 (IDO2) (NM_194294) Human Mass Spec Standard

CAT#: PH323337

IDO2 MS Standard C13 and N15-labeled recombinant protein (NP_919270)

Product Images

Coomassie blue staining of purified IDO2 protein (Cat# TP323337). The protein was produced from HEK293T cells transfected with IDO2 cDNA clone (Cat# RC223337) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223337
• Predicted MW: 46.9 kDa
• Protein Sequence:
  Sequence Link

  >RC223337 representing NM_194294
  Red=Cloning site Green=Tags(s)
  
  MLHFHYYDTSNKIMEPHRPNVKTAVPLSLESYHISEEYGFLLPDSLKELPDHYRPWMEIANKLPQLIDAH
  QLQAHVDKMPLLSCQFLKGHREQRLAHLVLSFLTMGYVWQEGEAQPAEVLPRNLALPFVEVSRNLGLPPI
  LVHSDLVLTNWTKKDPDGFLEIGNLETIISFPGGESLHGFILVTALVEKEAVPGIKALVQATNAILQPNQ
  EALLQALQRLRLSIQDITKTLGQMHDYVDPDIFYAGIRIFLSGWKDNPAMPAGLMYEGVSQEPLKYSGGS
  AAQSTVLHAFDEFLGIRHSKESGDFLYRMRDYMPPSHKAFIEDIHSAPSLRDYILSSGQDHLLTAYNQCV
  QALAELRSYHITMVTKYLITAAAKAKHGKPNHLPGPPQALKDRGTGGTAVMSFLKSVRDKTLESILHPRG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_919270
• RefSeq Size: 2294
• RefSeq ORF: 1260
• Synonyms: INDOL1
• Locus ID: 169355
• UniProt ID: Q6ZQW0
• Cytogenetics: 8p11.21
• Summary: Along with the enzymes encoded by the INDO (MIM 147435) and TDO2 (MIM 191070) genes, the enzyme encoded by the INDOL1 gene metabolizes tryptophan in the kynurenine pathway (Ball et al., 2007 [PubMed 17499941]).[supplied by OMIM, Feb 2011]
• Protein Pathways: Metabolic pathways, Tryptophan metabolism