NICE2 (S100A7A) (NM_176823) Human Mass Spec Standard
CAT#: PH321177
S100A7A MS Standard C13 and N15-labeled recombinant protein (NP_789793)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221177 |
Predicted MW | 11.1 kDa |
Protein Sequence |
>RC221177 representing NM_176823
Red=Cloning site Green=Tags(s) MSNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKI DFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_789793 |
RefSeq Size | 4351 |
RefSeq ORF | 303 |
Synonyms | NICE-2; NICE2; S100A7f; S100A7L1; S100A15 |
Locus ID | 338324 |
UniProt ID | Q86SG5 |
Cytogenetics | 1q21.3 |
Summary | May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406111 | S100A7A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY406111 | Transient overexpression lysate of S100 calcium binding protein A7A (S100A7A) |
USD 436.00 |
|
TP321177 | Recombinant protein of human S100 calcium binding protein A7A (S100A7A), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review