NICE2 (S100A7A) (NM_176823) Human Mass Spec Standard

CAT#: PH321177

S100A7A MS Standard C13 and N15-labeled recombinant protein (NP_789793)

Product Images

Coomassie blue staining of purified S100A7A protein (Cat# TP321177). The protein was produced from HEK293T cells transfected with S100A7A cDNA clone (Cat# RC221177) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221177
• Predicted MW: 11.1 kDa
• Protein Sequence:
  Sequence Link

  >RC221177 representing NM_176823
  Red=Cloning site Green=Tags(s)
  
  MSNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKI
  DFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_789793
• RefSeq Size: 4351
• RefSeq ORF: 303
• Synonyms: NICE-2; NICE2; S100A7f; S100A7L1; S100A15
• Locus ID: 338324
• UniProt ID: Q86SG5
• Cytogenetics: 1q21.3
• Summary: May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.[UniProtKB/Swiss-Prot Function]