VAMP1 (NM_014231) Human Mass Spec Standard
CAT#: PH320854
VAMP1 MS Standard C13 and N15-labeled recombinant protein (NP_055046)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220854 |
Predicted MW | 12.7 kDa |
Protein Sequence |
>RC220854 representing NM_014231
Red=Cloning site Green=Tags(s) MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRAD ALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_055046 |
RefSeq Size | 2748 |
RefSeq ORF | 354 |
Synonyms | CMS25; SPAX1; SYB1; VAMP-1 |
Locus ID | 6843 |
UniProt ID | P23763 |
Cytogenetics | 12p13.31 |
Summary | Synapotobrevins, syntaxins, and the synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Mutations in this gene are associated with autosomal dominant spastic ataxia 1. Multiple alternative splice variants have been described, but the full-length nature of some variants has not been defined. [provided by RefSeq, Jul 2014] |
Protein Families | Secreted Protein, Transmembrane |
Protein Pathways | SNARE interactions in vesicular transport |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404313 | VAMP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC413817 | VAMP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC415422 | VAMP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC429412 | VAMP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY404313 | Transient overexpression lysate of vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 2 |
USD 436.00 |
|
LY413817 | Transient overexpression lysate of vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 3 |
USD 436.00 |
|
LY415422 | Transient overexpression lysate of vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 1 |
USD 436.00 |
|
TP320854 | Recombinant protein of human vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review