C10orf53 (NM_001042427) Human Mass Spec Standard
CAT#: PH320657
C10orf53 MS Standard C13 and N15-labeled recombinant protein (NP_001035892)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220657 |
Predicted MW | 10.2 kDa |
Protein Sequence |
>RC220657 representing NM_001042427
Red=Cloning site Green=Tags(s) MPKNAVVILRYGPYSAAGLPVEHHTFRLQGLQAVLAIDGHEVILEKIEDWNVVELMVNEEVIFHCNIKDL EFGGDGKLDPLCEKARIAVLNAY myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001035892 |
RefSeq Size | 642 |
RefSeq ORF | 279 |
Locus ID | 282966 |
UniProt ID | Q8N6V4 |
Cytogenetics | 10q11.23 |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405479 | C10orf53 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC420897 | C10orf53 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY405479 | Transient overexpression lysate of chromosome 10 open reading frame 53 (C10orf53), transcript variant 1 |
USD 436.00 |
|
LY420897 | Transient overexpression lysate of chromosome 10 open reading frame 53 (C10orf53), transcript variant 2 |
USD 436.00 |
|
TP320657 | Recombinant protein of human chromosome 10 open reading frame 53 (C10orf53), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review