UBE2D2 (NM_003339) Human Mass Spec Standard

CAT#: PH318795

UBE2D2 MS Standard C13 and N15-labeled recombinant protein (NP_003330)

Product Images

Coomassie blue staining of purified UBE2D2 protein (Cat# TP318795). The protein was produced from HEK293T cells transfected with UBE2D2 cDNA clone (Cat# RC218795) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218795
• Predicted MW: 16.7 kDa
• Protein Sequence:
  Sequence Link

  >RC218795 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT
  TRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIARE
  WTQKYAM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003330
• RefSeq Size: 2715
• RefSeq ORF: 441
• Synonyms: E2(17)KB2; PUBC1; UBC4; UBC4/5; UBCH4; UBCH5B
• Locus ID: 7322
• UniProt ID: P62837
• Cytogenetics: 5q31.2
• Summary: Regulated degradation of misfolded, damaged or short-lived proteins in eukaryotes occurs via the ubiquitin (Ub)-proteasome system (UPS). An integral part of the UPS system is the ubiquitination of target proteins and covalent linkage of Ub-containing proteins to form polymeric chains, marking them as targets for 26S proteasome-mediated degradation. Ubiquitination of proteins is mediated by a cascade of enzymes which includes E1 (ubiquitin activating), E2 (ubiquitin conjugating), and E3 (ubiquitin ligases) enzymes. This gene encodes a member of the E2 enzyme family. Substrates of this enzyme include the tumor suppressor protein p53 and peroxisomal biogenesis factor 5 (PEX5). Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013]
• Protein Pathways: Ubiquitin mediated proteolysis