HAO1 (NM_017545) Human Mass Spec Standard
CAT#: PH316834
HAO1 MS Standard C13 and N15-labeled recombinant protein (NP_060015)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216834 |
Predicted MW | 40.9 kDa |
Protein Sequence |
>RC216834 protein sequence
Red=Cloning site Green=Tags(s) MLPRLICINDYEQHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAETDLSTSVLGQR VSMPICVGATAMQRMAHVDGELATVRACQSLGTGMMLSSWATSSIEEVAEAGPEALRWLQLYIYKDREVT KKLVRQAEKMGYKAIFVTVDTPYLGNRLDDVRNRFKLPPQLRMKNFETSTLSFSPEENFGDDSGLAAYVA KAIDPSISWEDIKWLRRLTSLPIVAKGILRGDDAREAVKHGLNGILVSNHGARQLDGVPATIDVLPEIVE AVEGKVEVFLDGGVRKGTDVLKALALGAKAVFVGRPIVWGLAFQGEKGVQDVLEILKEEFRLAMALSGCQ NVKVIDKTLVRKNPLAVSKI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_060015 |
RefSeq Size | 1746 |
RefSeq ORF | 1110 |
Synonyms | GOX; GOX1; HAOX1 |
Locus ID | 54363 |
UniProt ID | Q9UJM8, A8K058 |
Cytogenetics | 20p12.3 |
Summary | This gene is one of three related genes that have 2-hydroxyacid oxidase activity yet differ in encoded protein amino acid sequence, tissue expression and substrate preference. Subcellular location of the encoded protein is the peroxisome. Specifically, this gene is expressed primarily in liver and pancreas and the encoded protein is most active on glycolate, a two-carbon substrate. The protein is also active on 2-hydroxy fatty acids. The transcript detected at high levels in pancreas may represent an alternatively spliced form or the use of a multiple near-consensus upstream polyadenylation site. [provided by RefSeq, Jul 2008] |
Protein Pathways | Glyoxylate and dicarboxylate metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413692 | HAO1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY413692 | Transient overexpression lysate of hydroxyacid oxidase (glycolate oxidase) 1 (HAO1) |
USD 436.00 |
|
TP316834 | Recombinant protein of human hydroxyacid oxidase (glycolate oxidase) 1 (HAO1), 20 µg |
USD 867.00 |
|
TP720251 | Recombinant protein of human hydroxyacid oxidase (glycolate oxidase) 1 (HAO1) |
USD 330.00 |
|
TP760664 | Purified recombinant protein of Human hydroxyacid oxidase (glycolate oxidase) 1 (HAO1), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review