METTL21D (VCPKMT) (NM_001040662) Human Mass Spec Standard
CAT#: PH316594
C14orf138 MS Standard C13 and N15-labeled recombinant protein (NP_001035752)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216594 |
Predicted MW | 21.3 kDa |
Protein Sequence |
>RC216594 representing NM_001040662
Red=Cloning site Green=Tags(s) MADTLESSLEDPLRSFVRVLEKRDGTVLRLQQYSSGGVGCVVWDAAIVLSKYLETPEFSGDGAHALSRRS VLELGSGTGAVGLMAATLGADVVVTDLEELQDLLKMNINMNKHLVTGSVQAKVLKWGEEIEGFPSPPDFI LMADCIYYEESLEPLLKTLKDISGFETCIICCYEQRTMGKNPEIEKKYFEKFPS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001035752 |
RefSeq Size | 1679 |
RefSeq ORF | 582 |
Synonyms | C14orf138; METTL21D; VCP-KMT |
Locus ID | 79609 |
UniProt ID | Q9H867 |
Cytogenetics | 14q21.3 |
Summary | Protein-lysine N-methyltransferase that specifically trimethylates 'Lys-315' of VCP/p97; this modification may decrease VCP ATPase activity.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411191 | VCPKMT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC421803 | VCPKMT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY411191 | Transient overexpression lysate of chromosome 14 open reading frame 138 (C14orf138), transcript variant 1 |
USD 436.00 |
|
LY421803 | Transient overexpression lysate of chromosome 14 open reading frame 138 (C14orf138), transcript variant 2 |
USD 436.00 |
|
PH323670 | C14orf138 MS Standard C13 and N15-labeled recombinant protein (NP_078834) |
USD 3,255.00 |
|
TP316594 | Recombinant protein of human chromosome 14 open reading frame 138 (C14orf138), transcript variant 2, 20 µg |
USD 867.00 |
|
TP323670 | Recombinant protein of human chromosome 14 open reading frame 138 (C14orf138), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review