DAP Kinase 2 (DAPK2) (NM_014326) Human Mass Spec Standard

CAT#: PH316274

DAPK2 MS Standard C13 and N15-labeled recombinant protein (NP_055141)

Product Images

Coomassie blue staining of purified DAPK2 protein (Cat# TP316274). The protein was produced from HEK293T cells transfected with DAPK2 cDNA clone (Cat# RC216274) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC216274
• Predicted MW: 42.7 kDa
• Protein Sequence:
  Sequence Link

  >RC216274 representing NM_014326
  Red=Cloning site Green=Tags(s)
  
  MFQASMRSPNMEPFKQQKVEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRGVSREE
  IEREVSILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEATSFIKQILDGVNYL
  HTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIEDGVEFKNIFGTPEFVAPEIVNYEPLGLEADM
  WSIGVITYILLSGASPFLGDTKQETLANITAVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEAL
  RHPWITPVDNQQAMVRRESVVNLENFRKQYVRRRWKLSFSIVSLCNHLTRSLMKKVHLRPDEDLRNCESD
  TEEDIARRKALHPRRRSSTS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055141
• RefSeq Size: 2628
• RefSeq ORF: 1110
• Synonyms: DRP-1; DRP1
• Locus ID: 23604
• UniProt ID: Q9UIK4, A0A024R603
• Cytogenetics: 15q22.31
• Summary: This gene encodes a protein that belongs to the serine/threonine protein kinase family. This protein contains a N-terminal protein kinase domain followed by a conserved calmodulin-binding domain with significant similarity to that of death-associated protein kinase 1 (DAPK1), a positive regulator of programmed cell death. Overexpression of this gene was shown to induce cell apoptosis. It uses multiple polyadenylation sites. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Bladder cancer, Pathways in cancer