DAPP1 (NM_014395) Human Mass Spec Standard

CAT#: PH315474

DAPP1 MS Standard C13 and N15-labeled recombinant protein (NP_055210)

Product Images

Coomassie blue staining of purified DAPP1 protein (Cat# TP315474). The protein was produced from HEK293T cells transfected with DAPP1 cDNA clone (Cat# RC215474) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215474
• Predicted MW: 32.6 kDa
• Protein Sequence:
  Sequence Link

  >RC215474 representing NM_014395
  Red=Cloning site Green=Tags(s)
  
  MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLY
  SLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYE
  SVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDL
  TECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQGEGTIRSRSFIFK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055210
• RefSeq Size: 2953
• RefSeq ORF: 840
• Synonyms: BAM32
• Locus ID: 27071
• UniProt ID: Q9UN19
• Cytogenetics: 4q23
• Summary: May act as a B-cell-associated adapter that regulates B-cell antigen receptor (BCR)-signaling downstream of PI3K.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Phosphatase
• Protein Pathways: B cell receptor signaling pathway