RAB12 (NM_001025300) Human Mass Spec Standard
CAT#: PH311472
RAB12 MS Standard C13 and N15-labeled recombinant protein (NP_001020471)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211472 |
Predicted MW | 27.1 kDa |
Protein Sequence |
>RC211472 representing NM_001025300
Red=Cloning site Green=Tags(s) MDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEA CKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMI DKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPL DILRNELSNSILSLQPEPEIPPELPPPRPHVRCC myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001020471 |
RefSeq Size | 2138 |
RefSeq ORF | 732 |
Locus ID | 201475 |
UniProt ID | Q6IQ22 |
Cytogenetics | 18p11.22 |
Summary | The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab may play a role in protein transport from recycling endosomes to lysosomes regulating, for instance, the degradation of the transferrin receptor. Involved in autophagy (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422432 | RAB12 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY422432 | Transient overexpression lysate of RAB12, member RAS oncogene family (RAB12) |
USD 436.00 |
|
TP311472 | Recombinant protein of human RAB12, member RAS oncogene family (RAB12), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review