Serum Amyloid A (SAA1) (NM_000331) Human Mass Spec Standard

CAT#: PH310664

SAA1 MS Standard C13 and N15-labeled recombinant protein (NP_000322)

Product Images

Coomassie blue staining of purified SAA1 protein (Cat# TP310664). The protein was produced from HEK293T cells transfected with SAA1 cDNA clone (Cat# RC210664) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210664
• Predicted MW: 13.5 kDa
• Protein Sequence:
  Sequence Link

  >RC210664 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGV
  WAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000322
• RefSeq Size: 678
• RefSeq ORF: 366
• Synonyms: PIG4; SAA; SAA2; TP53I4
• Locus ID: 6288
• UniProt ID: P02735, P0DJI8
• Cytogenetics: 11p15.1
• Summary: This gene encodes a member of the serum amyloid A family of apolipoproteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a major acute phase protein that is highly expressed in response to inflammation and tissue injury. This protein also plays an important role in HDL metabolism and cholesterol homeostasis. High levels of this protein are associated with chronic inflammatory diseases including atherosclerosis, rheumatoid arthritis, Alzheimer's disease and Crohn's disease. This protein may also be a potential biomarker for certain tumors. Finally, antimicrobial activity against S. aureus and E. coli resides in the N-terminal portion of the mature protein. Alternate splicing results in multiple transcript variants that encode the same protein. A pseudogene of this gene is found on chromosome 11. [provided by RefSeq, Jul 2020]