MTRFR (NM_152269) Human Mass Spec Standard

CAT#: PH309162

C12orf65 MS Standard C13 and N15-labeled recombinant protein (NP_689482)

Product Images

Coomassie blue staining of purified C12orf65 protein (Cat# TP309162). The protein was produced from HEK293T cells transfected with C12orf65 cDNA clone (Cat# RC209162) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209162
• Predicted MW: 18.8 kDa
• Protein Sequence:
  Sequence Link

  >RC209162 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSTVGLFHFPTPLTRICPAPWGLRLWEKLTLLSPGIAVTPVQMAGKKDYPALLSLDENELEEQFVKGHGP
  GGQATNKTSNCVVLKHIPSGIVVKCHQTRSVDQNRKLARKILQEKVDVFYNGENSPVHKEKREAAKKKQE
  RKKRAKETLEKKKLLKELWESSKKVH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_689482
• RefSeq Size: 1692
• RefSeq ORF: 498
• Synonyms: C12orf65; COXPD7; SPG55
• Locus ID: 91574
• UniProt ID: Q9H3J6
• Cytogenetics: 12q24.31
• Summary: This nuclear gene encodes a mitochondrial matrix protein that appears to contribute to peptide chain termination in the mitochondrial translation machinery. Two different 1 bp deletions (resulting in the same premature stop codon)result in decreased mitochondrial translation, decreased levels of oxidative phosphorylation complexes and encepthalomyopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2010]