VANGL1 (NM_138959) Human Mass Spec Standard

CAT#: PH309024

VANGL1 MS Standard C13 and N15-labeled recombinant protein (NP_620409)

Product Images

Coomassie blue staining of purified VANGL1 protein (Cat# TP309024). The protein was produced from HEK293T cells transfected with VANGL1 cDNA clone (Cat# RC209024) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209024
• Predicted MW: 60 kDa
• Protein Sequence:
  Sequence Link

  >RC209024 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDTESTYSGYSYYSSHSKKSHRQGERTRERHKSPRNKDGRGSEKSVTIQPPTGEPLLGNDSTRTEEVQDD
  NWGETTTAITGTSEHSISQEDIARISKDMEDSVGLDCKRYLGLTVASFLGLLVFLTPIAFILLPPILWRD
  ELEPCGTICEGLFISMAFKLLILLIGTWALFFRKRRADMPRVFVFRALLLVLIFLFVVSYWLFYGVRILD
  SRDRNYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVL
  ENYYKDFTIYNPNLLTASKFRAAKHMAGLKVYNVDGPSNNATGQSRAMIAAAARRRDSSHNELYYEEAEH
  ERRVKKRKARLVVAVEEAFIHIQRLQAEEQQKAPGEVMDPREAAQAIFPSMARALQKYLRITRQQNYHSM
  ESILQHLAFCITNGMTPKAFLERYLSAGPTLQYDKDRWLSTQWRLVSDEAVTNGLRDGIVFVLKCLDFSL
  VVNVKKIPFIILSEEFIDPKSHKFVLRLQSETSV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_620409
• RefSeq Size: 8691
• RefSeq ORF: 1572
• Synonyms: KITENIN; LPP2; STB2; STBM2
• Locus ID: 81839
• UniProt ID: Q8TAA9, A0A024R0E3
• Cytogenetics: 1p13.1
• Summary: This gene encodes a member of the tretraspanin family. The encoded protein may be involved in mediating intestinal trefoil factor induced wound healing in the intestinal mucosa. Mutations in this gene are associated with neural tube defects. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Feb 2010]
• Protein Families: Transmembrane
• Protein Pathways: Wnt signaling pathway