VASH2 (NM_024749) Human Mass Spec Standard
CAT#: PH308692
VASH2 MS Standard C13 and N15-labeled recombinant protein (NP_079025)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208692 |
Predicted MW | 35.4 kDa |
Protein Sequence |
>RC208692 protein sequence
Red=Cloning site Green=Tags(s) MTGSAADTHRCPHPKGAKGTRSRSSHARPVSLATSGGSEEEDKDGGVLFHVNKSGFPIDSHTWERMWMHV AKVHPKGGEMVGAIRNAAFLAKPSIPQVPNYRLSMTIPDWLQAIQNYMKTLHYLTNGQPSIERFPISFKT YFSGNYFHHVVLGIYCNGRYGSLGMSRRAELMDKPLTFRTLSDLIFDFEDSYKKYLHTVKKVKIGLYVPH EPHSFQPIEWKQLVLNVSKMLRADIRKELEKYARDMRMKILKPASAHSPTQVRSRGKSLSPRRRQASPPR RLGRREKSPALPEKKVADLSTLNEVGYQIRI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_079025 |
RefSeq Size | 4362 |
RefSeq ORF | 933 |
Locus ID | 79805 |
UniProt ID | Q86V25, A8K4K8 |
Cytogenetics | 1q32.3 |
Summary | Tyrosine carboxypeptidase that removes the C-terminal tyrosine residue of alpha-tubulin, thereby regulating microtubule dynamics and function (PubMed:29146869). Acts as an activator of angiogenesis: expressed in infiltrating mononuclear cells in the sprouting front to promote angiogenesis (PubMed:19204325).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411100 | VASH2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC427885 | VASH2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC427886 | VASH2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY411100 | Transient overexpression lysate of vasohibin 2 (VASH2), transcript variant 1 |
USD 436.00 |
|
LY427885 | Transient overexpression lysate of vasohibin 2 (VASH2), transcript variant 2 |
USD 436.00 |
|
LY427886 | Transient overexpression lysate of vasohibin 2 (VASH2), transcript variant 3 |
USD 436.00 |
|
TP308692 | Recombinant protein of human vasohibin 2 (VASH2), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review