IFTAP (NM_138787) Human Mass Spec Standard
CAT#: PH308417
C11orf74 MS Standard C13 and N15-labeled recombinant protein (NP_620142)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208417 |
Predicted MW | 25.4 kDa |
Protein Sequence |
>RC208417 protein sequence
Red=Cloning site Green=Tags(s) MSAHMSGLEIMDEDQLIKDVLDKFLNCHEQTYDEEFLNTFTHLSQEDHVSKRGVFGTDSSENIFTSAKVT HKNEADDYHLRNKTIFLRTSSQCLEEQVDNFLDLEDLDMDEEIKPQMSEDLLLLPGEVEQDVSTSIPSCI PFVAQPPTCEVKPKPSVKRMDKQTEEILGDEVQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRK DTSPDLEKSCD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_620142 |
RefSeq Size | 911 |
RefSeq ORF | 663 |
Synonyms | C11orf74; HEPIS; NWC |
Locus ID | 119710 |
UniProt ID | Q86VG3, A8K468 |
Cytogenetics | 11p12 |
Summary | This gene encodes a protein that was identified as a cellular interacting partner of non-structural protein 10 of the severe acute respiratory syndrome coronavirus (SARS-CoV). The encoded protein may function as a negative regulator of transcription. There is a pseudogene for this gene on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2013] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408524 | C11orf74 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY408524 | Transient overexpression lysate of chromosome 11 open reading frame 74 (C11orf74) |
USD 436.00 |
|
TP308417 | Recombinant protein of human chromosome 11 open reading frame 74 (C11orf74), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review