KCNIP1 (NM_014592) Human Mass Spec Standard

CAT#: PH308255

KCNIP1 MS Standard C13 and N15-labeled recombinant protein (NP_055407)

Product Images

Coomassie blue staining of purified KCNIP1 protein (Cat# TP308255). The protein was produced from HEK293T cells transfected with KCNIP1 cDNA clone (Cat# RC208255) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208255
• Predicted MW: 25.2 kDa
• Protein Sequence:
  Sequence Link

  >RC208255 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGAVMGTFSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVN
  EDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDG
  YINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQ
  LFQNVM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055407
• RefSeq Size: 2028
• RefSeq ORF: 648
• Synonyms: KCHIP1; VABP
• Locus ID: 30820
• UniProt ID: Q9NZI2, Q9NZI2-2
• Cytogenetics: 5q35.1
• Summary: This gene encodes a member of the family of cytosolic voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the neuronal calcium sensor (NCS) family of the calcium binding EF-hand proteins. They associate with Kv4 alpha subunits to form native Kv4 channel complexes. The encoded protein may regulate rapidly inactivating (A-type) currents, and hence neuronal membrane excitability, in response to changes in the concentration of intracellular calcium. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013]
• Protein Families: Druggable Genome, Ion Channels: Other