MAGEB4 (NM_002367) Human Mass Spec Standard

CAT#: PH306060

MAGEB4 MS Standard C13 and N15-labeled recombinant protein (NP_002358)

Product Images

Coomassie blue staining of purified MAGEB4 protein (Cat# TP306060). The protein was produced from HEK293T cells transfected with MAGEB4 cDNA clone (Cat# RC206060) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206060
• Predicted MW: 39 kDa
• Protein Sequence:
  Sequence Link

  >RC206060 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPRGQKSKLRAREKRQRTRGQTQDLKVGQPTAAEKEESPSPSSSVLRDTASSSLAFGIPQEPQREPPTTS
  AAAAMSCTGSDKGDESQDEENASSSQASTSTERSLKDSLTRKTKMLVQFLLYKYKMKEPTTKAEMLKIIS
  KKYKEHFPEIFRKVSQRTELVFGLALKEVNPTTHSYILVSMLGPNYGNQSSAWTLPRNGLLMPLLSVIFL
  NGNCAREEEIWEFLNMLGIYDGKRHLIFGEPRKLITQDLVQEKYLEYQQVPNSDPPRYQFLWGPRAHAET
  SKMKVLEFLAKVNDTTPNNFPLLYEEALRDEEERAGARPRVAARRGTTAMTSAYSRATSSSSSQPM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002358
• RefSeq Size: 2266
• RefSeq ORF: 1038
• Synonyms: CT3.6
• Locus ID: 4115
• UniProt ID: O15481
• Cytogenetics: Xp21.2
• Summary: This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEB genes are clustered on chromosome Xp22-p21. This gene sequence ends in the first intron of MAGEB1, another family member. This gene is expressed in testis. [provided by RefSeq, Jul 2008]